Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3IP2 Peptide - N-terminal region

TRAF3IP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CIKS, DKFZp586G0522, MGC3581, PSORS13

UniProt

O43734

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAF3IP2 Rabbit Polyclonal Antibody (orb581865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671733

Preservative

Lyophilized powder

AA Sequence

IPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDH1 (101-193) mouse monoclonal antibody, clone 1D2, Purified
AM31915PU-N 50 µg

MDH1 (101-193) mouse monoclonal antibody, clone 1D2, Purified

Sign In for Pricing
View Details
Exportin 1 Polyclonal Antibody, PerCP Conjugated
bs-10151R-PerCP 100 µL

Exportin 1 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
KS 3000 i control incubator shaker
SHA2590 1 Each

KS 3000 i control incubator shaker

Sign In for Pricing
View Details
FAM57B Antibody - C-terminal region
MBS3209745-01 0.1 mL

FAM57B Antibody - C-terminal region

Sign In for Pricing
View Details
FAM57B Antibody - C-terminal region
MBS3209745-02 5x 0.1 mL

FAM57B Antibody - C-terminal region

Sign In for Pricing
View Details
3-Pyridylboronic acid pinacol ester
287533-01 2 g

3-Pyridylboronic acid pinacol ester

Sign In for Pricing
View Details