Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC1 Peptide - middle region

TRAPPC1 Peptide - middle region

Product Specifications

Product Name Alternative

BET5, MUM2

UniProt

Q2KMM2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAPPC1 Rabbit Polyclonal Antibody (orb326214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067033

Preservative

Lyophilized powder

AA Sequence

YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp64 3'UTR Lenti-reporter-Luc Vector
51063084 1.0 µg

Zfp64 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CLN5 Conjugated Antibody
orb1623143 100 µL

CLN5 Conjugated Antibody

Sign In for Pricing
View Details
UQCRC1 (Complex III subunit core 1) (35-480, His-tag) Human Protein
AR51414PU-N 500 µg

UQCRC1 (Complex III subunit core 1) (35-480, His-tag) Human Protein

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP-3, Stromelysin-1, SL-1, Transin) (FITC) discontinued
M2421-19-FITC 100 µL

Matrix Metalloproteinase 3 (MMP-3, Stromelysin-1, SL-1, Transin) (FITC) discontinued

Sign In for Pricing
View Details
Phospho-RAC1 + RAC2 (Ser71) Polyclonal Antibody, Cy7 Conjugated
bs-5698R-Cy7 100 µL

Phospho-RAC1 + RAC2 (Ser71) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Human APOA1
P9837-01 50 µg

Recombinant Human APOA1

Sign In for Pricing
View Details