Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM1 Peptide - C-terminal region

TREM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TREM-1, CD354

UniProt

Q9NP99

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREM1 Rabbit Polyclonal Antibody (orb585679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061113

Preservative

Lyophilized powder

AA Sequence

LCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Laminin Alpha 1 (LAMA1)
RPU56757-01 50 µg

Recombinant Laminin Alpha 1 (LAMA1)

Sign In for Pricing
View Details
Recombinant Laminin Alpha 1 (LAMA1)
RPU56757-02 100 µg

Recombinant Laminin Alpha 1 (LAMA1)

Sign In for Pricing
View Details
Recombinant Laminin Alpha 1 (LAMA1)
RPU56757-03 1 mg

Recombinant Laminin Alpha 1 (LAMA1)

Sign In for Pricing
View Details
CDK7 Rabbit Polyclonal Antibody (Biotin)
orb2081389 100 µL

CDK7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal CDX2 Antibody (PCRP-CDX2-1A3)
NBP2-75758-100ug 100 µg

Mouse Monoclonal CDX2 Antibody (PCRP-CDX2-1A3)

Sign In for Pricing
View Details
Nutrient Agar w/MUG
73153-01 100 g

Nutrient Agar w/MUG

Sign In for Pricing
View Details