Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trerf1 Peptide - N-terminal region

Trerf1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9430096I18Rik, AI429294, B830015H24, MGC118525, RAPA, Trep-132, Trep132

UniProt

Q8BXJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trerf1 Rabbit Polyclonal Antibody (orb577280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766210

Preservative

Lyophilized powder

AA Sequence

MGDQQLYKTNHVGHGGENLFYQQPPLGVHSGLGHSYGNTISGAGMDAPQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, sarcomeric muscle (ABT-SCA) Mouse mAb
E2252901 100 µL

Actin, sarcomeric muscle (ABT-SCA) Mouse mAb

Sign In for Pricing
View Details
TTF1 Rabbit Polyclonal Antibody (Biotin)
orb2096326 100 µL

TTF1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Fatty Acid Binding Protein, Adipocyte (AFABP, FABP4) discontinued
F0019-74B 100 µg

Fatty Acid Binding Protein, Adipocyte (AFABP, FABP4) discontinued

Sign In for Pricing
View Details
LOC502176 Adenovirus (Rat)
27316056 1.0 mL

LOC502176 Adenovirus (Rat)

Sign In for Pricing
View Details
ACTG1 3'UTR Lenti-reporter-Luc Vector
11245081 1.0 µg

ACTG1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Natural killer cells antigen CD94, KLRD1 ELISA Kit
MBS1608721-01 48 Well

Mouse Natural killer cells antigen CD94, KLRD1 ELISA Kit

Sign In for Pricing
View Details