Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIB1 Peptide - C-terminal region

TRIB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C8FW, GIG2, SKIP1, TRB1

UniProt

Q96RU8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIB1 Rabbit Polyclonal Antibody (orb330688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079471

Preservative

Lyophilized powder

AA Sequence

REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSF1 pSer303 Rabbit Polyclonal Antibody
AP20867PU-N 100 µg

HSF1 pSer303 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZC4H2 (NM_001178033) Human Over-expression Lysate
LY432640 100 µg

ZC4H2 (NM_001178033) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Siglec 7 Recombinant Rabbit monoclonal Antibody
HA723394B 100 µL

Human Siglec 7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CDC42 (NM_001039802) Human Over-expression Lysate
LC421832 20 µg

CDC42 (NM_001039802) Human Over-expression Lysate

Sign In for Pricing
View Details
Human COL7 (Collagen Type VII) ELISA Kit
E-EL-H0781-01 24 Tests

Human COL7 (Collagen Type VII) ELISA Kit

Sign In for Pricing
View Details
Human COL7 (Collagen Type VII) ELISA Kit
E-EL-H0781-02 48 Tests

Human COL7 (Collagen Type VII) ELISA Kit

Sign In for Pricing
View Details