Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIB1 Peptide - C-terminal region

TRIB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C8FW, GIG2, SKIP1, TRB1

UniProt

Q96RU8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIB1 Rabbit Polyclonal Antibody (orb330688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079471

Preservative

Lyophilized powder

AA Sequence

REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA (PC10), Biotin conjugate, 0.1mg/mL
BNCB0467-100 1x 100 µL

PCNA (PC10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4933405O20Rik Mouse Gene Knockout Kit (CRISPR)
KN500438 1 Kit

4933405O20Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MAP7D3 activation kit by CRISPRa
GA112518 1 Kit

Human MAP7D3 activation kit by CRISPRa

Sign In for Pricing
View Details
Purified Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215A-01 25 µg

Purified Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
Purified Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215A-02 100 µg

Purified Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
SLAP2 (SLA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]
TA505124AM 100 µL

SLAP2 (SLA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]

Sign In for Pricing
View Details