TRIM25 Peptide - middle region
TRIM25 Peptide - middle region
Product Specifications
Product Name Alternative
EFP, RNF147, Z147, ZNF147
UniProt
Q14258
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM25 Rabbit Polyclonal Antibody (orb583871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005073
Preservative
Lyophilized powder
AA Sequence
LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AMM19632VCF 100 µg
MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: LBI5H5]
Sign In for Pricing
View Details 
039643-Biotin 200 µL
PAPD5, NT (PAPD5, PAP-associated domain-containing protein 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2) (Biotin) discontinued
Sign In for Pricing
View Details 
P1050 2 mL Each
Protease and phosphatase inhibitor cocktail for mammalian cell and tissue extracts, 50X
Sign In for Pricing
View Details L2075-ML750 100 µL
LHX2/Lim (Lim Region Containing Transcription Factor) (MaxLight 750) discontinued
Sign In for Pricing
View Details K3446706 1.0 µg DNA
Clvs1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details