Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim3 Peptide - N-terminal region

Trim3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BERP1, HAC1, Rnf22

UniProt

Q9R1R2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim3 Rabbit Polyclonal Antibody (orb583786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061368

Preservative

Lyophilized powder

AA Sequence

FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plum Extract
E3413-25mg 25 mg

Plum Extract

Sign In for Pricing
View Details
ENKD1 siRNA (Human)
MBS8204643-01 15 nmol

ENKD1 siRNA (Human)

Sign In for Pricing
View Details
ENKD1 siRNA (Human)
MBS8204643-02 30 nmol

ENKD1 siRNA (Human)

Sign In for Pricing
View Details
ENKD1 siRNA (Human)
MBS8204643-03 5x 30 nmol

ENKD1 siRNA (Human)

Sign In for Pricing
View Details
ZNF496 (NM_032752) Human Recombinant Protein
PH40288M5 20 µg

ZNF496 (NM_032752) Human Recombinant Protein

Sign In for Pricing
View Details
GPR92 polyclonal antibody
BS67254-01 50 µL

GPR92 polyclonal antibody

Sign In for Pricing
View Details