Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim3 Peptide - N-terminal region

Trim3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BERP1, HAC1, Rnf22

UniProt

Q9R1R2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim3 Rabbit Polyclonal Antibody (orb583786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061368

Preservative

Lyophilized powder

AA Sequence

FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCER2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV626349 1.0 µg DNA

FCER2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit anti-JIK/TAOK3 Antibody, Affinity Purified
A300-535A-T 10 µg

Rabbit anti-JIK/TAOK3 Antibody, Affinity Purified

Sign In for Pricing
View Details
Multiplex Assay Kit for Xanthine Dehydrogenase (XDH), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029396 96 Tests

Multiplex Assay Kit for Xanthine Dehydrogenase (XDH), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
12-Ursene-3,16,22-triol
orb1683918 1 mg

12-Ursene-3,16,22-triol

Sign In for Pricing
View Details
CPEB1 Recombinant Protein
32-3585-20 20 µg

CPEB1 Recombinant Protein

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody (PE)
orb2364252 100 µL

GFAP Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details