Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim36 Peptide - N-terminal region

Trim36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Trim36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim36 Rabbit Polyclonal Antibody (orb578768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099617

Preservative

Lyophilized powder

AA Sequence

ESTKSCMDCSASYCNECFKIYHPWGTVKAQHEYVGPTTNFRPKILMCPEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DNAI3 Antibody
RN-14551-01 50 μL

Recombinant DNAI3 Antibody

Sign In for Pricing
View Details
Recombinant DNAI3 Antibody
RN-14551-02 100 µL

Recombinant DNAI3 Antibody

Sign In for Pricing
View Details
Recombinant DNAI3 Antibody
RN-14551-03 1 mL

Recombinant DNAI3 Antibody

Sign In for Pricing
View Details
ZNF385B Antibody
KC-3353-01 50 μL

ZNF385B Antibody

Sign In for Pricing
View Details
ZNF385B Antibody
KC-3353-02 100 µL

ZNF385B Antibody

Sign In for Pricing
View Details
ZNF385B Antibody
KC-3353-03 1 mL

ZNF385B Antibody

Sign In for Pricing
View Details