Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim36 Peptide - N-terminal region

Trim36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Trim36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim36 Rabbit Polyclonal Antibody (orb578768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099617

Preservative

Lyophilized powder

AA Sequence

ESTKSCMDCSASYCNECFKIYHPWGTVKAQHEYVGPTTNFRPKILMCPEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 1 (AQP1) (NM_198098) Human Over-expression Lysate
LC403670 20 µg

Aquaporin 1 (AQP1) (NM_198098) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Fastkd2 activation kit by CRISPRa
GA210287 1 Kit

Mouse Fastkd2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS716043 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
CD45 / LCA (2B11), Biotin conjugate, 0.1mg/mL
BNCB0470-100 1x 100 µL

CD45 / LCA (2B11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C13orf15 (RGCC) (NM_014059) Human Recombinant Protein
TP309810 20 µg

C13orf15 (RGCC) (NM_014059) Human Recombinant Protein

Sign In for Pricing
View Details
2-Phenylbenzothiazole
TRC-P336635-500MG 500 mg

2-Phenylbenzothiazole

Sign In for Pricing
View Details