Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM38 Peptide - middle region

TRIM38 Peptide - middle region

Product Specifications

Product Name Alternative

MGC8946, RNF15, RORET

UniProt

O00635

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM38 Rabbit Polyclonal Antibody (orb583744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006346

Preservative

Lyophilized powder

AA Sequence

LRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tropomyosin 3 (TPM3) (NM_001278188) Human Tagged ORF Clone
RG236349 10 µg

Tropomyosin 3 (TPM3) (NM_001278188) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF647 conjugate, 0.1mg/mL
BNC472958-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Leptin Receptor (LEPR) Rabbit Polyclonal Antibody
TA371133 100 µL

Leptin Receptor (LEPR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF583 (NM_001159860) Human Over-expression Lysate
LC431991 20 µg

ZNF583 (NM_001159860) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL
BNC940041-500 1x 500 µL

Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HNRNPC (NM_001077442) Human Over-expression Lysate
LC421419 20 µg

HNRNPC (NM_001077442) Human Over-expression Lysate

Sign In for Pricing
View Details