Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM38 Peptide - middle region

TRIM38 Peptide - middle region

Product Specifications

Product Name Alternative

MGC8946, RNF15, RORET

UniProt

O00635

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM38 Rabbit Polyclonal Antibody (orb583744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006346

Preservative

Lyophilized powder

AA Sequence

LRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen VI (COL6A1) (NM_001848) Human Over-expression Lysate
LY419706 100 µg

Collagen VI (COL6A1) (NM_001848) Human Over-expression Lysate

Sign In for Pricing
View Details
CORO2B (NM_001190457) Human Over-expression Lysate
LC434260 20 µg

CORO2B (NM_001190457) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Hydroxydecanoic Acid
TRC-H943233-10MG 10 mg

3-Hydroxydecanoic Acid

Sign In for Pricing
View Details
Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH
HA710253 100 µg

Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
ZNF124 (N-term) Rabbit Polyclonal Antibody
AP54669PU-N 400 µL

ZNF124 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details