Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49 Peptide - middle region

TRIM49 Peptide - middle region

Product Specifications

Product Name Alternative

RNF18, TRIM49L2

UniProt

Q9NS80

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49 Rabbit Polyclonal Antibody (orb583848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065091

Preservative

Lyophilized powder

AA Sequence

VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lipocalin 4 (LCN4) Protein
abx067800-01 10 µg

Mouse Lipocalin 4 (LCN4) Protein

Sign In for Pricing
View Details
Mouse Lipocalin 4 (LCN4) Protein
abx067800-02 50 µg

Mouse Lipocalin 4 (LCN4) Protein

Sign In for Pricing
View Details
Mouse Lipocalin 4 (LCN4) Protein
abx067800-03 100 µg

Mouse Lipocalin 4 (LCN4) Protein

Sign In for Pricing
View Details
Mouse Lipocalin 4 (LCN4) Protein
abx067800-04 200 µg

Mouse Lipocalin 4 (LCN4) Protein

Sign In for Pricing
View Details
Mouse Lipocalin 4 (LCN4) Protein
abx067800-05 500 µg

Mouse Lipocalin 4 (LCN4) Protein

Sign In for Pricing
View Details
Anti-BFP antibody
STJ97107 200 µl

Anti-BFP antibody

Sign In for Pricing
View Details