Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM54 Peptide - N-terminal region

TRIM54 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MURF, MURF-3, RNF30, muRF3

UniProt

Q9BYV2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM54 Rabbit Polyclonal Antibody (orb578803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115935

Preservative

Lyophilized powder

AA Sequence

IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dub1a Protein Vector (Mouse) (pPB-C-His)
PV173622 500 ng

Dub1a Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
H2-D1 Antibody (Biotin)
orb1251095 0.5 mg

H2-D1 Antibody (Biotin)

Sign In for Pricing
View Details
VRL1 (TRPV2) (NM_016113) Human Tagged ORF Clone
RG202821 10 µg

VRL1 (TRPV2) (NM_016113) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ndufa7 (NM_023202) Mouse Tagged ORF Clone
MR200458 10 µg

Ndufa7 (NM_023202) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SNAP 25 Lentiviral Activation Particles (h)
sc-401138-LAC 200 µL

SNAP 25 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
ABHD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
11095066 1.0 µg DNA

ABHD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details