Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM54 Peptide - N-terminal region

TRIM54 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MURF, MURF-3, RNF30, muRF3

UniProt

Q9BYV2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM54 Rabbit Polyclonal Antibody (orb578803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115935

Preservative

Lyophilized powder

AA Sequence

IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B13 siRNA (Mouse)
CRN3647-01 15 nmol

HSD17B13 siRNA (Mouse)

Sign In for Pricing
View Details
HSD17B13 siRNA (Mouse)
CRN3647-02 30 nmol

HSD17B13 siRNA (Mouse)

Sign In for Pricing
View Details
Lithium citrate
orb1942839-01 5 mg

Lithium citrate

Sign In for Pricing
View Details
Lithium citrate
orb1942839-02 50 mg

Lithium citrate

Sign In for Pricing
View Details
OR10H5 Peptide
DF10224-BP 1 mg

OR10H5 Peptide

Sign In for Pricing
View Details
6-Fluoro-5-methyl-[1,1'-biphenyl]-3-carbaldehyde
PC1018064-01 250 mg

6-Fluoro-5-methyl-[1,1'-biphenyl]-3-carbaldehyde

Sign In for Pricing
View Details