Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM65 Peptide - C-terminal region

TRIM65 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4732463G12Rik

UniProt

Q6PJ69

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM65 Rabbit Polyclonal Antibody (orb575196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775818

Preservative

Lyophilized powder

AA Sequence

MDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylacetyl L-Glutamine
TRC-P306500-50MG 50 mg

Phenylacetyl L-Glutamine

Sign In for Pricing
View Details
TRAF5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A3]
TA810371AM 100 µL

TRAF5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A3]

Sign In for Pricing
View Details
Ethyl-9,10-ethanoanthracene-9(10H)-propanoate
TRC-E676560-25MG 25 mg

Ethyl-9,10-ethanoanthracene-9(10H)-propanoate

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF640R conjugate, 0.1mg/mL
BNC401497-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Il2 Mouse Gene Knockout Kit (CRISPR)
KN308264LP 1 Kit

Il2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRC43 (NM_001098519) Human Over-expression Lysate
LC420617 20 µg

LRRC43 (NM_001098519) Human Over-expression Lysate

Sign In for Pricing
View Details