Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM65 Peptide - C-terminal region

TRIM65 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4732463G12Rik

UniProt

Q6PJ69

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM65 Rabbit Polyclonal Antibody (orb575196) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775818

Preservative

Lyophilized powder

AA Sequence

MDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glyphosate
TRC-G765000-25G 25 g

Glyphosate

Sign In for Pricing
View Details
HindIII, 2500U
RV1276 2500 U

HindIII, 2500U

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF405S conjugate, 0.1mg/mL
BNC042878-100 1x 100 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS510523 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
Desfluoro 5-Hydroxy Orbifloxacin
TRC-D290077-100MG 100 mg

Desfluoro 5-Hydroxy Orbifloxacin

Sign In for Pricing
View Details
Human TAS2R42 activation kit by CRISPRa
GA117721 1 Kit

Human TAS2R42 activation kit by CRISPRa

Sign In for Pricing
View Details