Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trmt5 Peptide - C-terminal region

Trmt5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610027O18Rik, KIAA1393, mKIAA1393

UniProt

Q9D0C4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trmt5 Rabbit Polyclonal Antibody (orb580551) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083856

Preservative

Lyophilized powder

AA Sequence

TKVRENNYTYEFDFSKVYWNPRLSTEHGRITELLNPGDVLFDVFAGVGPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmx1 sgRNA CRISPR Lentivector set (Mouse)
K3696701 3x 1.0 µg

Tmx1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human FCER2 / Low affinity immunoglobulin epsilon Fc receptor Recombinant Protein
R1007h 1 Each

Human FCER2 / Low affinity immunoglobulin epsilon Fc receptor Recombinant Protein

Sign In for Pricing
View Details
3- (4-Fluoro-3-methylphenyl) -3-oxetanol
PC1014026-01 250 mg

3- (4-Fluoro-3-methylphenyl) -3-oxetanol

Sign In for Pricing
View Details
3- (4-Fluoro-3-methylphenyl) -3-oxetanol
PC1014026-02 500 mg

3- (4-Fluoro-3-methylphenyl) -3-oxetanol

Sign In for Pricing
View Details
3- (4-Fluoro-3-methylphenyl) -3-oxetanol
PC1014026-03 1 g

3- (4-Fluoro-3-methylphenyl) -3-oxetanol

Sign In for Pricing
View Details
RAB15 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV680227 1.0 µg DNA

RAB15 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details