Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trmt5 Peptide - C-terminal region

Trmt5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610027O18Rik, KIAA1393, mKIAA1393

UniProt

Q9D0C4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trmt5 Rabbit Polyclonal Antibody (orb580551) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083856

Preservative

Lyophilized powder

AA Sequence

TKVRENNYTYEFDFSKVYWNPRLSTEHGRITELLNPGDVLFDVFAGVGPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Serine racemase
E15214h 96 Tests

ELISA Kit For Serine racemase

Sign In for Pricing
View Details
SCRN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2104606 1.0 µg DNA

SCRN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Z-Val-D-Phe-OMe
FV111562-01 10 g

Z-Val-D-Phe-OMe

Sign In for Pricing
View Details
Z-Val-D-Phe-OMe
FV111562-02 25 g

Z-Val-D-Phe-OMe

Sign In for Pricing
View Details
Lentiviral human AMIGO1 shRNA (UAS) - Lentiviral human AMIGO1 shRNA (UAS, iRFP) plasmid
GTR15111964 1 Vial

Lentiviral human AMIGO1 shRNA (UAS) - Lentiviral human AMIGO1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal MFSD12 Antibody
NBP2-48783 0.1 mL

Rabbit Polyclonal MFSD12 Antibody

Sign In for Pricing
View Details