Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT6 Peptide - middle region

TRMT6 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-09, GCD10, Gcd10p, MGC5029

UniProt

Q9UJA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT6 Rabbit Polyclonal Antibody (orb583310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057023

Preservative

Lyophilized powder

AA Sequence

GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6 gamma (PDE6G) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]
TA503739AM 100 µL

PDE6 gamma (PDE6G) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]

Sign In for Pricing
View Details
ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF808262 100 µg

ZFP200 (ZNF200) Mouse Monoclonal Antibody [Clone ID: OTI4C4]

Sign In for Pricing
View Details
Alpha Tubulin Recombinant Rabbit monoclonal Antibody
HA750584 100 µL

Alpha Tubulin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PRPS1 Mouse Monoclonal Antibody [Clone ID: AT1E11]
AM50064PU-N 100 µL

PRPS1 Mouse Monoclonal Antibody [Clone ID: AT1E11]

Sign In for Pricing
View Details
LTA4H Polyclonal Antibody
E-AB-15180-01 20 µL

LTA4H Polyclonal Antibody

Sign In for Pricing
View Details
LTA4H Polyclonal Antibody
E-AB-15180-02 60 µL

LTA4H Polyclonal Antibody

Sign In for Pricing
View Details