Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT6 Peptide - middle region

TRMT6 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-09, GCD10, Gcd10p, MGC5029

UniProt

Q9UJA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT6 Rabbit Polyclonal Antibody (orb583310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057023

Preservative

Lyophilized powder

AA Sequence

GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-23/IL-23 (C-6His)
PKSH033877-01 10 µg

Recombinant Human Interleukin-23/IL-23 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Interleukin-23/IL-23 (C-6His)
PKSH033877-02 50 µg

Recombinant Human Interleukin-23/IL-23 (C-6His)

Sign In for Pricing
View Details
Mouse F2 activation kit by CRISPRa
GA201334 1 Kit

Mouse F2 activation kit by CRISPRa

Sign In for Pricing
View Details
c8orf84 (SBSPON) (NM_153225) Human Over-expression Lysate
LC432161 20 µg

c8orf84 (SBSPON) (NM_153225) Human Over-expression Lysate

Sign In for Pricing
View Details
2,2’-Dibenzothiazoyl Disulfide
TRC-D417020-250G 250 g

2,2’-Dibenzothiazoyl Disulfide

Sign In for Pricing
View Details
Dopamine Transporter Recombinant Chimeric Antibody Antibody
HA601476 100 µL

Dopamine Transporter Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details