Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp63 Peptide - middle region

Trp63 Peptide - middle region

Product Specifications

Product Name Alternative

AI462811, Ket, MGC115972, P51/P63, P63, P73l, Tp63, Trp53rp1

UniProt

Q9WV31

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trp63 Rabbit Polyclonal Antibody (orb324507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061260

Preservative

Lyophilized powder

AA Sequence

VTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDP2 (Tyrosyl-DNA Phosphodiesterase 2, TTRAP, EAP2, AD022, EAPII, HTDP2, DJ30M3.3, RP1-30M3.3) discontinued
220307 50 µg

TDP2 (Tyrosyl-DNA Phosphodiesterase 2, TTRAP, EAP2, AD022, EAPII, HTDP2, DJ30M3.3, RP1-30M3.3) discontinued

Sign In for Pricing
View Details
RASAL1 Polyclonal Antibody
MBS9135100-01 0.02 mL

RASAL1 Polyclonal Antibody

Sign In for Pricing
View Details
RASAL1 Polyclonal Antibody
MBS9135100-02 0.1 mL

RASAL1 Polyclonal Antibody

Sign In for Pricing
View Details
RASAL1 Polyclonal Antibody
MBS9135100-03 5x 0.1 mL

RASAL1 Polyclonal Antibody

Sign In for Pricing
View Details
Apcin A HCL
M26003-01 1 g

Apcin A HCL

Sign In for Pricing
View Details
Apcin A HCL
M26003-02 500 mg

Apcin A HCL

Sign In for Pricing
View Details