Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp63 Peptide - middle region

Trp63 Peptide - middle region

Product Specifications

Product Name Alternative

AI462811, Ket, MGC115972, P51/P63, P63, P73l, Tp63, Trp53rp1

UniProt

Q9WV31

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trp63 Rabbit Polyclonal Antibody (orb324507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061260

Preservative

Lyophilized powder

AA Sequence

VTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Langerin Antibody / CD207
V8856-20UG 20 µg

Recombinant Langerin Antibody / CD207

Sign In for Pricing
View Details
CD71 (Phospho-Ser24) Polyclonal Antibody
MBS8585534-01 0.1 mg

CD71 (Phospho-Ser24) Polyclonal Antibody

Sign In for Pricing
View Details
CD71 (Phospho-Ser24) Polyclonal Antibody
MBS8585534-02 0.1 mL (AF405L)

CD71 (Phospho-Ser24) Polyclonal Antibody

Sign In for Pricing
View Details
CD71 (Phospho-Ser24) Polyclonal Antibody
MBS8585534-03 0.1 mL (AF405S)

CD71 (Phospho-Ser24) Polyclonal Antibody

Sign In for Pricing
View Details
CD71 (Phospho-Ser24) Polyclonal Antibody
MBS8585534-04 0.1 mL (AF610)

CD71 (Phospho-Ser24) Polyclonal Antibody

Sign In for Pricing
View Details
CD71 (Phospho-Ser24) Polyclonal Antibody
MBS8585534-05 0.1 mL (AF635)

CD71 (Phospho-Ser24) Polyclonal Antibody

Sign In for Pricing
View Details