Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trpv6 Peptide - middle region

Trpv6 Peptide - middle region

Product Specifications

Product Name Alternative

CaT1, Ecac2, Otrpc3

UniProt

Q9R186

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trpv6 Rabbit Polyclonal Antibody (orb575431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_446138

Preservative

Lyophilized powder

AA Sequence

TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse brain-gut peptides (BGP) ELISA Kit
MBS260257-01 48 Well

Mouse brain-gut peptides (BGP) ELISA Kit

Sign In for Pricing
View Details
Mouse brain-gut peptides (BGP) ELISA Kit
MBS260257-02 96 Well

Mouse brain-gut peptides (BGP) ELISA Kit

Sign In for Pricing
View Details
Mouse brain-gut peptides (BGP) ELISA Kit
MBS260257-03 5x 96 Well

Mouse brain-gut peptides (BGP) ELISA Kit

Sign In for Pricing
View Details
Mouse brain-gut peptides (BGP) ELISA Kit
MBS260257-04 10x 96 Well

Mouse brain-gut peptides (BGP) ELISA Kit

Sign In for Pricing
View Details
ZNF266 shRNA Plasmid (h)
sc-97683-SH 20 µg

ZNF266 shRNA Plasmid (h)

Sign In for Pricing
View Details
JDTic
A3517-5 5 mg

JDTic

Sign In for Pricing
View Details