Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trpv6 Peptide - middle region

Trpv6 Peptide - middle region

Product Specifications

Product Name Alternative

CaT1, Ecac2, Otrpc3

UniProt

Q9R186

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trpv6 Rabbit Polyclonal Antibody (orb575431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_446138

Preservative

Lyophilized powder

AA Sequence

TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Guanylate kinase (GUK1) ELISA kit
GTR10403453 96 Well

Monkey Guanylate kinase (GUK1) ELISA kit

Sign In for Pricing
View Details
Rat Tpd52 Pre-designed siRNA Set A
SI215058A 1 Each

Rat Tpd52 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human ZCCHC17 shRNA (UAS) - Lentiviral human ZCCHC17 shRNA (UAS, GFP) plasmid
GTR15101374 1 Vial

Lentiviral human ZCCHC17 shRNA (UAS) - Lentiviral human ZCCHC17 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
C11orf49 (NM_001003676) Human Recombinant Protein
E45H32327E1 50 µg

C11orf49 (NM_001003676) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human ATP6V1B2 Protein, N-His
YHD44901 100 μg

Recombinant Human ATP6V1B2 Protein, N-His

Sign In for Pricing
View Details
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu
MBS6252174-01 0.1 mL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu

Sign In for Pricing
View Details