Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRUB1 Peptide - C-terminal region

TRUB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PUS4

UniProt

Q8WWH5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRUB1 Rabbit Polyclonal Antibody (orb585472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631908

Preservative

Lyophilized powder

AA Sequence

KWTIDDIAQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKRED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5B Protein, Human, Recombinant (ECD, His Tag)
E45H50163M2-50 50 µg

UNC5B Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details
CBPA4 Polyclonal Antibody
MBS8529888-01 0.1 mg

CBPA4 Polyclonal Antibody

Sign In for Pricing
View Details
CBPA4 Polyclonal Antibody
MBS8529888-02 0.1 mL (AF635)

CBPA4 Polyclonal Antibody

Sign In for Pricing
View Details
CBPA4 Polyclonal Antibody
MBS8529888-03 0.1 mL (AF610)

CBPA4 Polyclonal Antibody

Sign In for Pricing
View Details
CBPA4 Polyclonal Antibody
MBS8529888-04 0.1 mL (AF405S)

CBPA4 Polyclonal Antibody

Sign In for Pricing
View Details
CBPA4 Polyclonal Antibody
MBS8529888-05 0.1 mL (AF405L)

CBPA4 Polyclonal Antibody

Sign In for Pricing
View Details