Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSEN2 Peptide - C-terminal region

TSEN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC2776, MGC4440, PCH2B, SEN2, SEN2L

UniProt

Q8NCE0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSEN2 Rabbit Polyclonal Antibody (orb585328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079541

Preservative

Lyophilized powder

AA Sequence

LRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal CFHR1 antibody - N-terminal region
APR01507G 0.05mg

Polyclonal CFHR1 antibody - N-terminal region

Sign In for Pricing
View Details
Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit
orb2809731-01 48 Tests

Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit

Sign In for Pricing
View Details
Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit
orb2809731-02 96 Tests

Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit

Sign In for Pricing
View Details
Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit
orb2809731-03 5 x 96 T

Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit

Sign In for Pricing
View Details
Diphenylterazine
C8200-50 50 mg

Diphenylterazine

Sign In for Pricing
View Details
Human PQ-loop repeat-containing protein 3, PQLC3 ELISA KIT
ELI-37844h 96 Tests

Human PQ-loop repeat-containing protein 3, PQLC3 ELISA KIT

Sign In for Pricing
View Details