Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP Peptide - C-terminal region

TSLP Peptide - C-terminal region

Product Specifications

UniProt

Q969D9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSLP Rabbit Polyclonal Antibody (orb584844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149024

Preservative

Lyophilized powder

AA Sequence

GCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-t-Boc-piperidine-4-spiro-5’-[1’,3’-bis-t-boc]hydantoin
TRC-B663125-250MG 250 mg

1-t-Boc-piperidine-4-spiro-5’-[1’,3’-bis-t-boc]hydantoin

Sign In for Pricing
View Details
TTPA (NM_000370) Human Over-expression Lysate
LC424763 20 µg

TTPA (NM_000370) Human Over-expression Lysate

Sign In for Pricing
View Details
SMYD1 (C-term) Rabbit Polyclonal Antibody
AP53954PU-N 400 µL

SMYD1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPCL1 (NM_001013631) Human Recombinant Protein
TP761090 50 µg

HNRNPCL1 (NM_001013631) Human Recombinant Protein

Sign In for Pricing
View Details
PSF2 (GINS2) Human Gene Knockout Kit (CRISPR)
KN400011 1 Kit

PSF2 (GINS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Amino-2-(4-hexylphenethyl)propane-1,3-diol hydrochloride
TRC-A399650-500MG 500 mg

2-Amino-2-(4-hexylphenethyl)propane-1,3-diol hydrochloride

Sign In for Pricing
View Details