Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP Peptide - C-terminal region

TSLP Peptide - C-terminal region

Product Specifications

UniProt

Q969D9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSLP Rabbit Polyclonal Antibody (orb584844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149024

Preservative

Lyophilized powder

AA Sequence

GCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACRG (NM_001080378) Human Over-expression Lysate
LY421606 100 µg

PACRG (NM_001080378) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Defa31 activation kit by CRISPRa
GA201054 1 Kit

Mouse Defa31 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Hexadecanoyl-4-Hydroxyproline
TRC-H293848-5MG 5 mg

N-Hexadecanoyl-4-Hydroxyproline

Sign In for Pricing
View Details
2-Mercaptoethanol (poison pk)
EC-603 50 mL

2-Mercaptoethanol (poison pk)

Sign In for Pricing
View Details
KDM2B (NM_001005366) Human Over-expression Lysate
LY423701 100 µg

KDM2B (NM_001005366) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NT-3 (Neurotrophin-3) CLIA Kit
E-CL-H1171-01 24 Tests

Human NT-3 (Neurotrophin-3) CLIA Kit

Sign In for Pricing
View Details