Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSN Peptide - middle region

TSN Peptide - middle region

Product Specifications

Product Name Alternative

BCLF-1, RCHF1, REHF-1, TBRBP, TRSLN

UniProt

Q15631

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSN Rabbit Polyclonal Antibody (orb585658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004613

Preservative

Lyophilized powder

AA Sequence

LVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA10 (Center) Rabbit Polyclonal Antibody
AP52073PU-N 400 µL

HOXA10 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS712348 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Bulk Anti-Human CD19 (SJ25-C1) Antibody
ICH1011-25mg 25 mg

Bulk Anti-Human CD19 (SJ25-C1) Antibody

Sign In for Pricing
View Details
Human Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) ELISA Kit
RDR-SLAMF7-Hu-01 96 Tests

Human Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) ELISA Kit

Sign In for Pricing
View Details
Human Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) ELISA Kit
RDR-SLAMF7-Hu-02 48 Tests

Human Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) ELISA Kit

Sign In for Pricing
View Details
NCOA7 (NM_181782) Human Recombinant Protein
TP321673L 1 mg

NCOA7 (NM_181782) Human Recombinant Protein

Sign In for Pricing
View Details