TSPAN1 Peptide - middle region
TSPAN1 Peptide - middle region
Product Specifications
Product Name Alternative
9030418M05Rik, NET-1, RP11-322N21.1, TSPAN-1, NET1, TM4C, TM4SF
UniProt
O60635
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TSPAN1 Rabbit Polyclonal Antibody (orb578856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005718
Preservative
Lyophilized powder
AA Sequence
TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MPX1341K Each
Magic™ Membrane Protein Mouse Reep1 (Receptor accessory protein 1) Expressed in vitro E.coli expression system, Full Length
Sign In for Pricing
View Details A15466-10mM-D 10 mM x 1mL in DMSO
Eliglustat tartrate 10mM * 1mL in DMSO
Sign In for Pricing
View Details 
LV662601 1.0 µg DNA
PLEKHG5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 