Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tspan33 Peptide - C-terminal region

Tspan33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1560915

UniProt

D3Z967

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tspan33 Rabbit Polyclonal Antibody (orb582884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102697

Preservative

Lyophilized powder

AA Sequence

NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-8-hydroxypurine-9-beta-D-(2',5'-di-O-acetyl-3'-deoxy)riboside
MBS5826960 Inquire

2-Amino-8-hydroxypurine-9-beta-D-(2',5'-di-O-acetyl-3'-deoxy)riboside

Sign In for Pricing
View Details
GC Antibody (Center) (Ascites)
orb2997107-01 50 µL

GC Antibody (Center) (Ascites)

Sign In for Pricing
View Details
GC Antibody (Center) (Ascites)
orb2997107-02 100 µL

GC Antibody (Center) (Ascites)

Sign In for Pricing
View Details
ATG3 Conjugated Antibody
MBS9444130-01 0.1 mL (Biotin)

ATG3 Conjugated Antibody

Sign In for Pricing
View Details
ATG3 Conjugated Antibody
MBS9444130-02 0.1 mL (AF350)

ATG3 Conjugated Antibody

Sign In for Pricing
View Details
ATG3 Conjugated Antibody
MBS9444130-03 0.1 mL (AF405)

ATG3 Conjugated Antibody

Sign In for Pricing
View Details