Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tspan33 Peptide - C-terminal region

Tspan33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1560915

UniProt

D3Z967

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tspan33 Rabbit Polyclonal Antibody (orb582884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102697

Preservative

Lyophilized powder

AA Sequence

NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat gp130 Affinity Purified Polyclonal Ab
AF5029-SP 25 µg

Rat gp130 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
PAMM (FAM213A) Human Over-expression Lysate
orb1351609 100 µg

PAMM (FAM213A) Human Over-expression Lysate

Sign In for Pricing
View Details
XYLT2 antibody
70R-7170 50 ug

XYLT2 antibody

Sign In for Pricing
View Details
SSSCA1 (Sjoegren Syndrome/scleroderma Autoantigen 1, Autoantigen p27) (MaxLight 490)
133875-ML490 100 µL

SSSCA1 (Sjoegren Syndrome/scleroderma Autoantigen 1, Autoantigen p27) (MaxLight 490)

Sign In for Pricing
View Details
AQP12B CRISPR Knock Out 293T Cell Line (Human)
12219141 1x 10^6 Cells / 1.0 mL

AQP12B CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Cstl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6574608 1.0 µg DNA

Cstl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details