Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC27 Peptide - N-terminal region

TTC27 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20272

UniProt

Q6P3X3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC27 Rabbit Polyclonal Antibody (orb326143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060205

Preservative

Lyophilized powder

AA Sequence

KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Oxo-1,4-dihydroquinoline-3-carboxamide
TRC-O990250-50MG 50 mg

4-Oxo-1,4-dihydroquinoline-3-carboxamide

Sign In for Pricing
View Details
Prtn3 Mouse Gene Knockout Kit (CRISPR)
KN514059 1 Kit

Prtn3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
RD-NME1-Ra-01 96 Tests

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details
Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
RD-NME1-Ra-02 48 Tests

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details
Isopentyl Nitrite
TRC-I821890-10G 10 g

Isopentyl Nitrite

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623919 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details