Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC27 Peptide - N-terminal region

TTC27 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20272

UniProt

Q6P3X3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC27 Rabbit Polyclonal Antibody (orb326143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060205

Preservative

Lyophilized powder

AA Sequence

KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wbp11 Mouse Gene Knockout Kit (CRISPR)
KN519319 1 Kit

Wbp11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit
RD-WNT4-Ra-01 96 Tests

Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit
RD-WNT4-Ra-02 48 Tests

Rat Wingless Type MMTV Integration Site Family, Member 4 (WNT4) ELISA Kit

Sign In for Pricing
View Details
SCHIP1 (NM_001197107) Human Over-expression Lysate
LY434259 100 µg

SCHIP1 (NM_001197107) Human Over-expression Lysate

Sign In for Pricing
View Details
Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D10]
TA503819BM 100 µL

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D10]

Sign In for Pricing
View Details
DGCR2 (NM_001173534) Human Over-expression Lysate
LY433199 100 µg

DGCR2 (NM_001173534) Human Over-expression Lysate

Sign In for Pricing
View Details