Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTF1 Peptide - middle region

TTF1 Peptide - middle region

Product Specifications

Product Name Alternative

TTF-1, TTF-I

UniProt

Q15361

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTF1 Rabbit Polyclonal Antibody (orb584946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031370

Preservative

Lyophilized powder

AA Sequence

KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human POLI Protein
E30P04132A 50 µg

Recombinant Human POLI Protein

Sign In for Pricing
View Details
ESD polyclonal antibody
BS7975-01 50 µL

ESD polyclonal antibody

Sign In for Pricing
View Details
ESD polyclonal antibody
BS7975-02 100 µL

ESD polyclonal antibody

Sign In for Pricing
View Details
Human Chitinase 3 Like Protein 2 (CHI3L2) ELISA Kit
EK13253 48 Tests

Human Chitinase 3 Like Protein 2 (CHI3L2) ELISA Kit

Sign In for Pricing
View Details
Tle3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7611607 1.0 µg DNA

Tle3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
ITI-H2 CRISPR Activation Plasmid (m2)
sc-421182-ACT-2 20 µg

ITI-H2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details