Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTF1 Peptide - middle region

TTF1 Peptide - middle region

Product Specifications

Product Name Alternative

TTF-1, TTF-I

UniProt

Q15361

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTF1 Rabbit Polyclonal Antibody (orb584946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031370

Preservative

Lyophilized powder

AA Sequence

KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ13236 CRISPR Activation Plasmid (h)
sc-413310-ACT 20 µg

FLJ13236 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (TR1.02) [FITC]
NBP2-80069F 0.1 mL

Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (TR1.02) [FITC]

Sign In for Pricing
View Details
Rabbit Polyclonal Cathepsin B Antibody [Alexa Fluor 532]
NBP1-19797AF532 0.1 mL

Rabbit Polyclonal Cathepsin B Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
EDA2R Antibody : FITC (OABF01784-FITC)
OABF01784-FITC 100 µL

EDA2R Antibody : FITC (OABF01784-FITC)

Sign In for Pricing
View Details
Goat IL12B (Interleukin 12B) ELISA Kit
MBS8804847-01 48 Well

Goat IL12B (Interleukin 12B) ELISA Kit

Sign In for Pricing
View Details
Goat IL12B (Interleukin 12B) ELISA Kit
MBS8804847-02 96 Well

Goat IL12B (Interleukin 12B) ELISA Kit

Sign In for Pricing
View Details