Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTPA Peptide - C-terminal region

TTPA Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATTP, AVED, TTP1, alphaTTP

UniProt

P49638

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTPA Rabbit Polyclonal Antibody (orb585485) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000361

Preservative

Lyophilized powder

AA Sequence

HAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine 5'-Monophosphate-13C5
TRC-A281782-1MG 1 mg

Adenosine 5'-Monophosphate-13C5

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS645392 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), 1mg/mL
BNUM0227-50 1x 50 µL

Milk Fat Globulin (MFG-06), 1mg/mL

Sign In for Pricing
View Details
Human ESRP2 activation kit by CRISPRa
GA112781 1 Kit

Human ESRP2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]
CL029BX 300 µg

CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]

Sign In for Pricing
View Details
Human WDR55 activation kit by CRISPRa
GA110312 1 Kit

Human WDR55 activation kit by CRISPRa

Sign In for Pricing
View Details