Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTPA Peptide - C-terminal region

TTPA Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATTP, AVED, TTP1, alphaTTP

UniProt

P49638

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTPA Rabbit Polyclonal Antibody (orb585485) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000361

Preservative

Lyophilized powder

AA Sequence

HAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

xCT/SLC7A11 Recombinant Mouse Monoclonal Antibody [A7C6-R]
HA601071 100 µL

xCT/SLC7A11 Recombinant Mouse Monoclonal Antibody [A7C6-R]

Sign In for Pricing
View Details
Uric Acid-1,3-15N2
TRC-U829203-10MG 10 mg

Uric Acid-1,3-15N2

Sign In for Pricing
View Details
BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR1C12]
TA592344 100 µL

BCL2 Rabbit Monoclonal Antibody [Clone ID: OTIR1C12]

Sign In for Pricing
View Details
Human Complement Factor P (CFP) ELISA Kit
RD-CFP-Hu-01 96 Tests

Human Complement Factor P (CFP) ELISA Kit

Sign In for Pricing
View Details
Human Complement Factor P (CFP) ELISA Kit
RD-CFP-Hu-02 48 Tests

Human Complement Factor P (CFP) ELISA Kit

Sign In for Pricing
View Details
O-Desethyl Dapagliflozin (>80%)
TRC-D290543-5MG 5 mg

O-Desethyl Dapagliflozin (>80%)

Sign In for Pricing
View Details