Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTYH3 Peptide - middle region

TTYH3 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1691

UniProt

Q9C0H2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTYH3 Rabbit Polyclonal Antibody (orb325525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079526

Preservative

Lyophilized powder

AA Sequence

IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-376a-3p miRNA Agomir
CMS0210-01 5 nmol

Rno-miR-376a-3p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-376a-3p miRNA Agomir
CMS0210-02 10 nmol

Rno-miR-376a-3p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-376a-3p miRNA Agomir
CMS0210-03 20 nmol

Rno-miR-376a-3p miRNA Agomir

Sign In for Pricing
View Details
Rat Deleted in lung and esophageal cancer protein 1, DLEC1 ELISA Kit
MBS9335892-01 48 Well

Rat Deleted in lung and esophageal cancer protein 1, DLEC1 ELISA Kit

Sign In for Pricing
View Details
Rat Deleted in lung and esophageal cancer protein 1, DLEC1 ELISA Kit
MBS9335892-02 96 Well

Rat Deleted in lung and esophageal cancer protein 1, DLEC1 ELISA Kit

Sign In for Pricing
View Details
Rat Deleted in lung and esophageal cancer protein 1, DLEC1 ELISA Kit
MBS9335892-03 5x 96 Well

Rat Deleted in lung and esophageal cancer protein 1, DLEC1 ELISA Kit

Sign In for Pricing
View Details