Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTYH3 Peptide - middle region

TTYH3 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1691

UniProt

Q9C0H2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTYH3 Rabbit Polyclonal Antibody (orb325525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079526

Preservative

Lyophilized powder

AA Sequence

IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cilostamide (OPC 3689)
444553-01 5 mg

Cilostamide (OPC 3689)

Sign In for Pricing
View Details
Cilostamide (OPC 3689)
444553-02 10 mg

Cilostamide (OPC 3689)

Sign In for Pricing
View Details
LILRA4 (aa68-78)
551422 100 µg

LILRA4 (aa68-78)

Sign In for Pricing
View Details
SPO11 Antibody (C-term)
orb164807-01 50 µL

SPO11 Antibody (C-term)

Sign In for Pricing
View Details
SPO11 Antibody (C-term)
orb164807-02 100 µL

SPO11 Antibody (C-term)

Sign In for Pricing
View Details
SMARCAD1 Human Over-expression Lysate
orb1376930 20 µg

SMARCAD1 Human Over-expression Lysate

Sign In for Pricing
View Details