Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tuba8 Peptide - N-terminal region

Tuba8 Peptide - N-terminal region

Product Specifications

UniProt

Q9JJZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tuba8 Rabbit Polyclonal Antibody (orb326180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059075

Preservative

Lyophilized powder

AA Sequence

ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT4 (5T1) Mouse Monoclonal antibody
E28PE1633 100 µL

OCT4 (5T1) Mouse Monoclonal antibody

Sign In for Pricing
View Details
FOXP3 Monoclonal Antibody
RDSA55153 100 µL

FOXP3 Monoclonal Antibody

Sign In for Pricing
View Details
Tpgs1 Rat shRNA Plasmid (Locus ID 691093)
TR708096 1 Kit

Tpgs1 Rat shRNA Plasmid (Locus ID 691093)

Sign In for Pricing
View Details
BCL10 antibody
70R-14043 0.1 mg

BCL10 antibody

Sign In for Pricing
View Details
Micropipette Acura 825 0.1-2 uL Socorex
DD61104 1 Each

Micropipette Acura 825 0.1-2 uL Socorex

Sign In for Pricing
View Details
Tret-butyl N- (2-oxo-1,3-oxazolidin-4-yl) carbamate
LLB79560-01 50 mg

Tret-butyl N- (2-oxo-1,3-oxazolidin-4-yl) carbamate

Sign In for Pricing
View Details