Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tuba8 Peptide - N-terminal region

Tuba8 Peptide - N-terminal region

Product Specifications

UniProt

Q9JJZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tuba8 Rabbit Polyclonal Antibody (orb326180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059075

Preservative

Lyophilized powder

AA Sequence

ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine C type lectin domain family 5 member A (CLEC5A) ELISA Kit
GTR10369420 96 Well

Canine C type lectin domain family 5 member A (CLEC5A) ELISA Kit

Sign In for Pricing
View Details
Ankrd36 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3181508 1.0 µg DNA

Ankrd36 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
NEK9 Knockout 786-O Polyclonal Cells
ARG5375 1 Million

NEK9 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
SIP1 Rabbit pAb, Pacific Blue conjugated
orb2874425 100 µL

SIP1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
TRIP15 (COPS2) Human Over-expression Lysate
orb1360717 20 µg

TRIP15 (COPS2) Human Over-expression Lysate

Sign In for Pricing
View Details
Rose Bengal (C.I. 45440)
GT2559-250g 250 g

Rose Bengal (C.I. 45440)

Sign In for Pricing
View Details