Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBG2 Peptide - middle region

TUBG2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC131994

UniProt

Q9NRH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBG2 Rabbit Polyclonal Antibody (orb325980) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057521

Preservative

Lyophilized powder

AA Sequence

FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM171A1 activation kit by CRISPRa
GA116588 1 Kit

Human FAM171A1 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC4A11 Antibody
8C18807-AAT 50 µg

SLC4A11 Antibody

Sign In for Pricing
View Details
KIF20A (Ab-528) Antibody
8B1082-AAT 50 µg

KIF20A (Ab-528) Antibody

Sign In for Pricing
View Details
Sample tube scanner BLIH-201
BLIH-201 Each

Sample tube scanner BLIH-201

Sign In for Pricing
View Details
2-(S)-Hydroxy-4-oxo-4-phenylbutyric Acid
TRC-H948875-50MG 50 mg

2-(S)-Hydroxy-4-oxo-4-phenylbutyric Acid

Sign In for Pricing
View Details
2-Hydroxyethyl Oleate
TRC-H545210-2.5G 2.5 g

2-Hydroxyethyl Oleate

Sign In for Pricing
View Details