Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Twf1 Peptide - C-terminal region

Twf1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC105817, Ptk9

UniProt

Q5RJR2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Twf1 Rabbit Polyclonal Antibody (orb330851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008521

Preservative

Lyophilized powder

AA Sequence

EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRX65 CRISPR Knock Out 293T Cell Line (Human)
30673141 1x 10^6 Cells / 1.0 mL

MRX65 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human CLU Recombinant Protein
PPT-11918 100 µg

Human CLU Recombinant Protein

Sign In for Pricing
View Details
TW24 CRYO-SENTRY Low Level Alarm
TW-R024-8C30 1 accessory

TW24 CRYO-SENTRY Low Level Alarm

Sign In for Pricing
View Details
Guinea pig Carbonic anhydrase 2 (CA-2) ELISA Kit
MBS2802791-01 48 Tests

Guinea pig Carbonic anhydrase 2 (CA-2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Carbonic anhydrase 2 (CA-2) ELISA Kit
MBS2802791-02 96 Tests

Guinea pig Carbonic anhydrase 2 (CA-2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Carbonic anhydrase 2 (CA-2) ELISA Kit
MBS2802791-03 5x 96 Tests

Guinea pig Carbonic anhydrase 2 (CA-2) ELISA Kit

Sign In for Pricing
View Details