Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Twf1 Peptide - C-terminal region

Twf1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC105817, Ptk9

UniProt

Q5RJR2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Twf1 Rabbit Polyclonal Antibody (orb330851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008521

Preservative

Lyophilized powder

AA Sequence

EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin-Converting Enzyme 2 (ACE2) Antibody
abx403761-01 100 µL

Angiotensin-Converting Enzyme 2 (ACE2) Antibody

Sign In for Pricing
View Details
Angiotensin-Converting Enzyme 2 (ACE2) Antibody
abx403761-02 200 µL

Angiotensin-Converting Enzyme 2 (ACE2) Antibody

Sign In for Pricing
View Details
Angiotensin-Converting Enzyme 2 (ACE2) Antibody
abx403761-03 1 mL

Angiotensin-Converting Enzyme 2 (ACE2) Antibody

Sign In for Pricing
View Details
LIN7A siRNA (Mouse)
CRN0894-01 15 nmol

LIN7A siRNA (Mouse)

Sign In for Pricing
View Details
LIN7A siRNA (Mouse)
CRN0894-02 30 nmol

LIN7A siRNA (Mouse)

Sign In for Pricing
View Details
GENLISA™ Fibroblast Growth Factor 9 (FGF9) ELISA
KLR3837 1x 96 Well

GENLISA™ Fibroblast Growth Factor 9 (FGF9) ELISA

Sign In for Pricing
View Details