Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNIP Peptide - middle region

TXNIP Peptide - middle region

Product Specifications

Product Name Alternative

EST01027, HHCPA78, THIF, VDUP1

UniProt

Q9H3M7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TXNIP Rabbit Polyclonal Antibody (orb584207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006463

Preservative

Lyophilized powder

AA Sequence

VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAAT3 Polyclonal Antibody
E-AB-17312-01 20 µL

EAAT3 Polyclonal Antibody

Sign In for Pricing
View Details
EAAT3 Polyclonal Antibody
E-AB-17312-02 60 µL

EAAT3 Polyclonal Antibody

Sign In for Pricing
View Details
EAAT3 Polyclonal Antibody
E-AB-17312-03 120 µL

EAAT3 Polyclonal Antibody

Sign In for Pricing
View Details
EAAT3 Polyclonal Antibody
E-AB-17312-04 200 µL

EAAT3 Polyclonal Antibody

Sign In for Pricing
View Details
Acox1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4369205 3x 1.0 µg

Acox1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Agrobacterium vitis Transcription elongation factor GreA (greA)
MBS1039754-01 0.02 mg (E-Coli)

Recombinant Agrobacterium vitis Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details