Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNIP Peptide - middle region

TXNIP Peptide - middle region

Product Specifications

Product Name Alternative

EST01027, HHCPA78, THIF, VDUP1

UniProt

Q9H3M7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TXNIP Rabbit Polyclonal Antibody (orb584207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006463

Preservative

Lyophilized powder

AA Sequence

VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRCAM Protein Vector (Mouse) (pPB-N-His)
PV206647 500 ng

NRCAM Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 650)
MBS6229348-01 0.1 mL

PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 650)

Sign In for Pricing
View Details
PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 650)
MBS6229348-02 5x 0.1 mL

PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 650)

Sign In for Pricing
View Details
Phosphoglycerate Kinase 1 (PGK1, Cell Migration-inducing Gene 10 Protein, MGC8947, MGC117307, MGC142128, MIG10, OK/SW-cl.110, PGKA, Primer Recognition Protein 2, PRP 2) (MaxLight 490) discontinued
P4073-13B-ML490 100 µL

Phosphoglycerate Kinase 1 (PGK1, Cell Migration-inducing Gene 10 Protein, MGC8947, MGC117307, MGC142128, MIG10, OK/SW-cl.110, PGKA, Primer Recognition Protein 2, PRP 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide
FC184342-01 10 mg

2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide

Sign In for Pricing
View Details
2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide
FC184342-02 25 mg

2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide

Sign In for Pricing
View Details