Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYK2 Peptide - C-terminal region

TYK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JTK1

UniProt

P29597

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003322

Preservative

Lyophilized powder

AA Sequence

HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS11 (SRSF11) (C-term) Rabbit Polyclonal Antibody
AP53877PU-N 400 µL

SFRS11 (SRSF11) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sgms1 Mouse Gene Knockout Kit (CRISPR)
KN515683 1 Kit

Sgms1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Desmin Antibody
RC-16809-01 50 μL

Recombinant Desmin Antibody

Sign In for Pricing
View Details
Recombinant Desmin Antibody
RC-16809-02 100 µL

Recombinant Desmin Antibody

Sign In for Pricing
View Details
Recombinant Desmin Antibody
RC-16809-03 1 mL

Recombinant Desmin Antibody

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) (NM_000583) Human Over-expression Lysate
LC400197 20 µg

Vitamin D Binding protein (GC) (NM_000583) Human Over-expression Lysate

Sign In for Pricing
View Details